C11orf82 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: C11orf82 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX05085
• Hersteller Artikelnummer: GTX05085
• Alternativnummer: GTX05085-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide derived from the C-terminal region of human DDIAS: AFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS
• Konjugation: Unconjugated
• Alternative Synonym: C11orf82,DDIAS,DNA damage induced apoptosis suppressor,noxin,Noxin

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 112
• NCBI: 220042
• UniProt: Q8IXT1
• Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid