C11orf82 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: C11orf82 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX05085
• Supplier Catalog Number: GTX05085
• Alternative Catalog Number: GTX05085-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide derived from the C-terminal region of human DDIAS: AFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS
• Conjugation: Unconjugated
• Alternative Names: C11orf82,DDIAS,DNA damage induced apoptosis suppressor,noxin,Noxin

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 112
• NCBI: 220042
• UniProt: Q8IXT1
• Buffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Form: Liquid