C16orf44 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
GTX05092
- Bilder (0)
| Artikelname: | C16orf44 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | GTX05092 |
| Hersteller Artikelnummer: | GTX05092 |
| Alternativnummer: | GTX05092-100 |
| Hersteller: | GeneTex |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | A synthetic peptide derived from the middle region of human C16orf44: EDMLVAIGGRNENGALSSVETYSPKTDSWSYVAGLPRFTYGHAGTIYKDF |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C16orf44,KLHL36,kelch like family member 36 |
| Anwendungsbeschreibung: | WB: 0.2-1 µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
