C16orf44 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: C16orf44 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX05092
• Hersteller Artikelnummer: GTX05092
• Alternativnummer: GTX05092-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide derived from the middle region of human C16orf44: EDMLVAIGGRNENGALSSVETYSPKTDSWSYVAGLPRFTYGHAGTIYKDF
• Konjugation: Unconjugated
• Alternative Synonym: C16orf44,KLHL36,kelch like family member 36

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 70
• NCBI: 79786
• UniProt: Q8N4N3
• Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.2-1 µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.