C16orf44 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: C16orf44 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX05092
• Supplier Catalog Number: GTX05092
• Alternative Catalog Number: GTX05092-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide derived from the middle region of human C16orf44: EDMLVAIGGRNENGALSSVETYSPKTDSWSYVAGLPRFTYGHAGTIYKDF
• Conjugation: Unconjugated
• Alternative Names: C16orf44,KLHL36,kelch like family member 36

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 70
• NCBI: 79786
• UniProt: Q8N4N3
• Buffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.2-1 µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.