C16orf44 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX05092
- Images (0)
| Article Name: | C16orf44 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX05092 |
| Supplier Catalog Number: | GTX05092 |
| Alternative Catalog Number: | GTX05092-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | A synthetic peptide derived from the middle region of human C16orf44: EDMLVAIGGRNENGALSSVETYSPKTDSWSYVAGLPRFTYGHAGTIYKDF |
| Conjugation: | Unconjugated |
| Alternative Names: | C16orf44,KLHL36,kelch like family member 36 |
| Application Notes: | WB: 0.2-1 µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
