TEFM antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: TEFM antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX05101
• Hersteller Artikelnummer: GTX05101
• Alternativnummer: GTX05101-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide directed towards the N-terminal region of Human TEFM (RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ).
• Konjugation: Unconjugated
• Alternative Synonym: C17orf42,TEFM,transcription elongation factor, mitochondrial

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 42
• NCBI: 79736
• UniProt: Q96QE5
• Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid