TEFM antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: TEFM antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX05101
• Supplier Catalog Number: GTX05101
• Alternative Catalog Number: GTX05101-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide directed towards the N-terminal region of Human TEFM (RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ).
• Conjugation: Unconjugated
• Alternative Names: C17orf42,TEFM,transcription elongation factor, mitochondrial

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 42
• NCBI: 79736
• UniProt: Q96QE5
• Buffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Form: Liquid