PML antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: PML antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX05122
• Hersteller Artikelnummer: GTX05122
• Alternativnummer: GTX05122-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide directed towards the C terminal region of human PML: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR
• Konjugation: Unconjugated
• Alternative Synonym: MYL,PML,PP8675,RNF71,TRIM19,promyelocytic leukemia

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 98
• Sensitivitaet: This antibody is specific for isoform 1, 9, 10 and 11 of PML protein.
• NCBI: 5371
• UniProt: P29590
• Puffer: PBS, 2% Sucrose, 0.09% Sodium azide.
• Formulierung: Liquid