PML antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX05122
- Images (0)
| Article Name: | PML antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX05122 |
| Supplier Catalog Number: | GTX05122 |
| Alternative Catalog Number: | GTX05122-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide directed towards the C terminal region of human PML: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR |
| Conjugation: | Unconjugated |
| Alternative Names: | MYL,PML,PP8675,RNF71,TRIM19,promyelocytic leukemia |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml (Please refer to the vial label for the specific concentration.) |
| Molecular Weight: | 98 |
| Sensitivity: | This antibody is specific for isoform 1, 9, 10 and 11 of PML protein. |
| NCBI: | 5371 |
| UniProt: | P29590 |
| Buffer: | PBS, 2% Sucrose, 0.09% Sodium azide. |
| Form: | Liquid |
Product Guarantee and Expert Support
