METTL24 Antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: METTL24 Antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX05139
• Hersteller Artikelnummer: GTX05139
• Alternativnummer: GTX05139-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL24: EWKVLENLILEDVLEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKE
• Konjugation: Unconjugated

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 41
• NCBI: 728464
• UniProt: Q5JXM2
• Puffer: PBS, 2% Sucrose, 0.09% Sodium azide.
• Formulierung: Liquid