METTL24 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX05139
- Images (0)
| Article Name: | METTL24 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX05139 |
| Supplier Catalog Number: | GTX05139 |
| Alternative Catalog Number: | GTX05139-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL24: EWKVLENLILEDVLEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKE |
| Conjugation: | Unconjugated |
