METTL24 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: METTL24 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX05139
• Supplier Catalog Number: GTX05139
• Alternative Catalog Number: GTX05139-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL24: EWKVLENLILEDVLEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKE
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 41
• NCBI: 728464
• UniProt: Q5JXM2
• Buffer: PBS, 2% Sucrose, 0.09% Sodium azide.
• Form: Liquid