sfTSLP (63 aa peptide)

Artikelnummer: ISC-AB-010
Artikelname: sfTSLP (63 aa peptide)
Artikelnummer: ISC-AB-010
Hersteller Artikelnummer: AB-010
Alternativnummer: ISC-AB-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
sfTSLP (63 aa peptide) is an antibacterial peptide derived as the 63 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP). Thymic stromal lymphopoietin (TSLP) is a cytokine first identified in a mouse model as a B-cell growth factor produced by a thymic stromal cell line. Two transcript variants of human TSLP are described: a long form of TSLP (lfTSLP, variant 1) and an alternative, short form (sfTSLP, variant 2). The sequence of sfTSLP has two potential starting methionines that can give rise to either a 63 or a 60aa peptide. Compared with lfTSLP, sfTSLP possesses stronger antibacterial activity and appears to act as an antimicrobial peptide in the oral cavity and on the skin to create a defense barrier that aids in the control microbes.
Molekulargewicht: 7425.86
NCBI: 2015
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Formel: C327H543N101O86S5
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Antimicrobial peptides