sfTSLP (63 aa peptide)

Product Overview

• Article Name: sfTSLP (63 aa peptide)
• Biozol Catalog Number: ISC-AB-010
• Supplier Catalog Number: AB-010
• Alternative Catalog Number: ISC-AB-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

sfTSLP (63 aa peptide) is an antibacterial peptide derived as the 63 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP). Thymic stromal lymphopoietin (TSLP) is a cytokine first identified in a mouse model as a B-cell growth fa

Product Properties

• Molecular Weight: 7425.86
• NCBI: 2015
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
• Formula: C327H543N101O86S5
• Target: Antibacterials

Application Notes

• Application Notes: ProductType: Antimicrobial peptides