LL 37 (human), CAS [[154947-66-7]]

Artikelnummer: ISC-AM-001
Artikelname: LL 37 (human), CAS [[154947-66-7]]
Artikelnummer: ISC-AM-001
Hersteller Artikelnummer: AM-001
Alternativnummer: ISC-AM-001
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Ropocamptide, hCAP 18, Cathelicidin, LL 37, LL-37, cathelicidin, LL 37 (human)
LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. In addition to its antimicrobial properties, LL 37 (human) modulates numerous pathways in autoimmune and inflammatory diseases and has a role in the pathogenesis of lupus, RA and atherosclerosis. As a binding partner to Abeta42, LL 37 (human) expression impacts initiation and progression of Alzheimers disease. LL 37 also has a significant role in human cancer, inducing tumourigenic effects in cancers of the ovary, lung, breast, prostate, pancreas, and also in malignant melanoma.
Molekulargewicht: 4493.3
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: [LL-37, 37 aa]
CAS Nummer: [154947-66-7]
Formel: C205H340N60O53
Target-Kategorie: Antibacterials,Antivirals
Anwendungsbeschreibung: ProductType: Antimicrobial peptides