LL 37 (human), CAS [[154947-66-7]]

Catalog Number: ISC-AM-001
Article Name: LL 37 (human), CAS [[154947-66-7]]
Biozol Catalog Number: ISC-AM-001
Supplier Catalog Number: AM-001
Alternative Catalog Number: ISC-AM-001
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Ropocamptide, hCAP 18, Cathelicidin, LL 37, LL-37, cathelicidin, LL 37 (human)
LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. In addition to its antimicrobial properties, LL 37 (human) modulates numerous pathways in autoimmune and inflammatory diseases and has a role in the pathogenesis of lupus, RA and atherosclerosis. As a binding partner to Abeta42, LL 37 (human) expression impacts initiation and progression of Alzheimers disease. LL 37 also has a significant role in human cancer, inducing tumourigenic effects in cancers of the ovary, lung, breast, prostate, pancreas, and also in malignant melanoma.
Molecular Weight: 4493.3
NCBI: 2013
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: [LL-37, 37 aa]
CAS Number: [154947-66-7]
Formula: C205H340N60O53
Target: Antibacterials,Antivirals
Application Notes: ProductType: Antimicrobial peptides