LL 37 (human) scrambled

Artikelnummer: ISC-AM-002
Artikelname: LL 37 (human) scrambled
Artikelnummer: ISC-AM-002
Hersteller Artikelnummer: AM-002
Alternativnummer: ISC-AM-002
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
LL 37, a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. LL 37 (human) scrambled is the control peptide for LL-37 [AM-001].
Molekulargewicht: 4493.3
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Formel: C205H340N60O53
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Antimicrobial peptides