LL 37 (human) scrambled

Catalog Number: ISC-AM-002
Article Name: LL 37 (human) scrambled
Biozol Catalog Number: ISC-AM-002
Supplier Catalog Number: AM-002
Alternative Catalog Number: ISC-AM-002
Manufacturer: Isca Biochemicals
Category: Biochemikalien
LL 37, a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. LL 37 (human) scrambled is the control peptide for LL-37 [AM-001].
Molecular Weight: 4493.3
NCBI: 2013
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Formula: C205H340N60O53
Target: Antibacterials
Application Notes: ProductType: Antimicrobial peptides