Apelin 36 (human), CAS [[252642-12-9]]

Artikelnummer: ISC-AR-010
Artikelname: Apelin 36 (human), CAS [[252642-12-9]]
Artikelnummer: ISC-AR-010
Hersteller Artikelnummer: AR-010
Alternativnummer: ISC-AR-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Apelin-36 (human) is an endogenous apelin receptor agonist that is secreted by adipocytes. Apelin-36 (human) binds with high affinity to human apelin receptors expressed in HEK 293 cells (pIC50= 8.61) and is linked to two major types of biological activity: cardiovascular, such as stimulation of cardiac contractility and suppression of blood pressure, and metabolic, including improving glucose homeostasis and lowering body weight, and regulation of cardiovascular function, fluid homeostasis and feeding.
Molekulargewicht: 4195.87
NCBI: 1998
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
CAS Nummer: [252642-12-9]
Formel: C184H297N69O43S
Target-Kategorie: Apelin receptors
Anwendungsbeschreibung: ProductType: Peptides