Apelin 36 (human), CAS [[252642-12-9]]

Catalog Number: ISC-AR-010
Article Name: Apelin 36 (human), CAS [[252642-12-9]]
Biozol Catalog Number: ISC-AR-010
Supplier Catalog Number: AR-010
Alternative Catalog Number: ISC-AR-010
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Apelin-36 (human) is an endogenous apelin receptor agonist that is secreted by adipocytes. Apelin-36 (human) binds with high affinity to human apelin receptors expressed in HEK 293 cells (pIC50= 8.61) and is linked to two major types of biological activity: cardiovascular, such as stimulation of cardiac contractility and suppression of blood pressure, and metabolic, including improving glucose homeostasis and lowering body weight, and regulation of cardiovascular function, fluid homeostasis and feeding.
Molecular Weight: 4195.87
NCBI: 1998
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
CAS Number: [252642-12-9]
Formula: C184H297N69O43S
Target: Apelin receptors
Application Notes: ProductType: Peptides