Peptide YY (human), CAS [[118997-30-1]]

Artikelnummer: ISC-GH-110
Artikelname: Peptide YY (human), CAS [[118997-30-1]]
Artikelnummer: ISC-GH-110
Hersteller Artikelnummer: GH-110
Alternativnummer: ISC-GH-110
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: PYY, PYY (1-36)
Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes.
Molekulargewicht: 4049.5
NCBI: 1980
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
CAS Nummer: [118997-30-1]
Formel: C194H295N55O57
Target-Kategorie: Neuropeptide Y receptors
Anwendungsbeschreibung: ProductType: Peptides