Peptide YY (human), CAS [[118997-30-1]]

Catalog Number: ISC-GH-110
Article Name: Peptide YY (human), CAS [[118997-30-1]]
Biozol Catalog Number: ISC-GH-110
Supplier Catalog Number: GH-110
Alternative Catalog Number: ISC-GH-110
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: PYY, PYY (1-36)
Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes.
Molecular Weight: 4049.5
NCBI: 1980
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
CAS Number: [118997-30-1]
Formula: C194H295N55O57
Target: Neuropeptide Y receptors
Application Notes: ProductType: Peptides