Neuromedin S (human), CAS [[1138204-27-9]]

Artikelnummer: ISC-NU-010
Artikelname: Neuromedin S (human), CAS [[1138204-27-9]]
Artikelnummer: ISC-NU-010
Hersteller Artikelnummer: NU-010
Alternativnummer: ISC-NU-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: NMS (human), hNMS-33
Neuromedin S (human) is a 33-amino acid neuropeptide, originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have since been identified as the neuromedin U receptors NMU1 and NMU2. Neuromedin S (human) shares an identical C-terminal heptapeptide with human neuromedin U, but unlike human neuromedin U, which is widely distributed in the CNS and peripheral tissues, neuromedin S (human) mainly exists in the suprachiasmatic nucleus in the CNS. Neuromedin S (human) primarily regulates biological rhythms.
Molekulargewicht: 3789.01
NCBI: 2005
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
CAS Nummer: [1138204-27-9]
Formel: C173H265N53O44
Target-Kategorie: Neuromedin U receptors
Anwendungsbeschreibung: ProductType: Peptides