Neuromedin S (human), CAS [[1138204-27-9]]

Catalog Number: ISC-NU-010
Article Name: Neuromedin S (human), CAS [[1138204-27-9]]
Biozol Catalog Number: ISC-NU-010
Supplier Catalog Number: NU-010
Alternative Catalog Number: ISC-NU-010
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: NMS (human), hNMS-33
Neuromedin S (human) is a 33-amino acid neuropeptide, originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have since been identified as the neuromedin U receptors NMU1 and NMU2. Neuromedin S (human) shares an identical C-terminal heptapeptide with human neuromedin U, but unlike human neuromedin U, which is widely distributed in the CNS and peripheral tissues, neuromedin S (human) mainly exists in the suprachiasmatic nucleus in the CNS. Neuromedin S (human) primarily regulates biological rhythms.
Molecular Weight: 3789.01
NCBI: 2005
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
CAS Number: [1138204-27-9]
Formula: C173H265N53O44
Target: Neuromedin U receptors
Application Notes: ProductType: Peptides