PACAP 27, CAS [[127317-03-7]]

Artikelnummer: ISC-PA-010
Artikelname: PACAP 27, CAS [[127317-03-7]]
Artikelnummer: ISC-PA-010
Hersteller Artikelnummer: PA-010
Alternativnummer: ISC-PA-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: PACAP 1-27, Pituitary Adenylate Cyclase-Activating Polypeptide 1-27, PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)
PACAP 27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 functions in the control of anterior pituitary hormone secretion, vasodilation, adrenaline secretion, insulin secretion and immunosuppression.
Molekulargewicht: 3147.65
NCBI: 1997
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
CAS Nummer: [127317-03-7]
Formel: C142H224N40O39S
Target-Kategorie: PACAP receptors
Anwendungsbeschreibung: ProductType: Peptides