PACAP 27, CAS [[127317-03-7]]

Product Overview

• Article Name: PACAP 27, CAS [[127317-03-7]]
• Biozol Catalog Number: ISC-PA-010
• Supplier Catalog Number: PA-010
• Alternative Catalog Number: ISC-PA-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: PACAP 1-27, Pituitary Adenylate Cyclase-Activating Polypeptide 1-27, PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)

Product Description

PACAP 27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 functions in the control of anterior pituitary hormone secretion, vasodilation, adrenaline secretion, insulin secretion and immunosuppression.

Product Properties

• Molecular Weight: 3147.65
• NCBI: 1997
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
• CAS Number: [127317-03-7]
• Formula: C142H224N40O39S
• Target: PACAP receptors

Application Notes

• Application Notes: ProductType: Peptides