Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]

Artikelnummer: ISC-PH-010
Artikelname: Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]
Artikelnummer: ISC-PH-010
Hersteller Artikelnummer: PH-010
Alternativnummer: ISC-PH-010
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34)
Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland. Intermittently administered parathyroid hormone (PTH 1-34) has been shown to promote bone formation in both human and animal studies. Parathyroid and its analogues stimulate both bone formation and resorption, and at low doses are in clinical use for the treatment of severe osteoporosis.
Molekulargewicht: 4117.77
NCBI: 1997
Reinheit: >95%
Formulierung: Freeze fried solid
Sequenz: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS Nummer: [52232-67-4]
Formel: C181H291N55O51S2
Target-Kategorie: Parathyroid hormone receptors
Anwendungsbeschreibung: ProductType: Peptides