Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]

Catalog Number: ISC-PH-010
Article Name: Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]
Biozol Catalog Number: ISC-PH-010
Supplier Catalog Number: PH-010
Alternative Catalog Number: ISC-PH-010
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34)
Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland. Intermittently administered parathyroid hormone (PTH 1-34) has been shown to promote bone formation in both human and animal studies. Parathyroid and its analogues stimulate both bone formation and resorption, and at low doses are in clinical use for the treatment of severe osteoporosis.
Molecular Weight: 4117.77
NCBI: 1997
Purity: >95%
Form: Freeze fried solid
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS Number: [52232-67-4]
Formula: C181H291N55O51S2
Target: Parathyroid hormone receptors
Application Notes: ProductType: Peptides