Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]

Artikelnummer: ISC-PH-040
Artikelname: Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]
Artikelnummer: ISC-PH-040
Hersteller Artikelnummer: PH-040
Alternativnummer: ISC-PH-040
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: pTH (1-34) (rat)
Parathyroid hormone (1-34) (rat) is a parathyroid hormone receptor agonist, which can increase serum parathyroid hormone levels and bone mass in rats. Parathyroid hormone (1-34) (rat) treatment significantly improved weight bearing and treadmill endurance, preserved GAG and collagen type II, and reduced the OARSI score and terminal differentiation markers in rat models of osteoarthritis. Parathyroid hormone (1-34) (rat) alleviates disease progression in a papain induced osteoarthritis in vivo rat model.
Molekulargewicht: 4057.74
NCBI: 1997
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
CAS Nummer: [98614-76-7]
Formel: C180H291N55O48S2
Target-Kategorie: Parathyroid hormone receptors
Anwendungsbeschreibung: ProductType: Peptides