Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]

Catalog Number: ISC-PH-040
Article Name: Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]
Biozol Catalog Number: ISC-PH-040
Supplier Catalog Number: PH-040
Alternative Catalog Number: ISC-PH-040
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: pTH (1-34) (rat)
Parathyroid hormone (1-34) (rat) is a parathyroid hormone receptor agonist, which can increase serum parathyroid hormone levels and bone mass in rats. Parathyroid hormone (1-34) (rat) treatment significantly improved weight bearing and treadmill endurance, preserved GAG and collagen type II, and reduced the OARSI score and terminal differentiation markers in rat models of osteoarthritis. Parathyroid hormone (1-34) (rat) alleviates disease progression in a papain induced osteoarthritis in vivo rat model.
Molecular Weight: 4057.74
NCBI: 1997
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
CAS Number: [98614-76-7]
Formula: C180H291N55O48S2
Target: Parathyroid hormone receptors
Application Notes: ProductType: Peptides