WaTx

Artikelnummer: ISC-PN-120
Artikelname: WaTx
Artikelnummer: ISC-PN-120
Hersteller Artikelnummer: PN-120
Alternativnummer: ISC-PN-120
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Wasabi receptor toxin
WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which it stabilizes in an active state characterized by prolonged channel openings and low Ca2+ permeability. WaTx elicits acute pain and pain hypersensitivity, but fails to trigger efferent release of neuropeptides and neurogenic inflammation typically produced by other toxins. WaTx is a unique pharmacological probe for dissecting TRPA1 function and its contribution to acute and persistent pain.
Molekulargewicht: 3855.3
NCBI: 2019
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS
Formel: C164H245N45O53S5
Target-Kategorie: Transient receptor potential (TRP) channels
Anwendungsbeschreibung: ProductType: Peptides