WaTx

Catalog Number: ISC-PN-120
Article Name: WaTx
Biozol Catalog Number: ISC-PN-120
Supplier Catalog Number: PN-120
Alternative Catalog Number: ISC-PN-120
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Wasabi receptor toxin
WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which it stabilizes in an active state characterized by prolonged channel openings and low Ca2+ permeability. WaTx elicits acute pain and pain hypersensitivity, but fails to trigger efferent release of neuropeptides and neurogenic inflammation typically produced by other toxins. WaTx is a unique pharmacological probe for dissecting TRPA1 function and its contribution to acute and persistent pain.
Molecular Weight: 3855.3
NCBI: 2019
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS
Formula: C164H245N45O53S5
Target: Transient receptor potential (TRP) channels
Application Notes: ProductType: Peptides