IHC-plus(TM) Polyclonal Rabbit anti-Human PVRL2 / CD112 Antibody (IHC, IF, WB) LS-B15413

Artikelnummer: LS-B15413-50
Artikelname: IHC-plus(TM) Polyclonal Rabbit anti-Human PVRL2 / CD112 Antibody (IHC, IF, WB) LS-B15413
Artikelnummer: LS-B15413-50
Hersteller Artikelnummer: LS-B15413-50
Alternativnummer: LS-B15413-50
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
Konjugation: Unconjugated
Alternative Synonym: PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2
CD112 antibody LS-B15413 is an unconjugated rabbit polyclonal antibody to human CD112 (PVRL2). Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Klonalität: Polyclonal
Konzentration: 1.22 mg/ml
NCBI: 5819
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.
Western blot analysis of extracts of various cell lines.
Immunofluorescence analysis of HeLa cells.