IHC-plus(TM) PVRL2 / CD112 Antibody LS-B15413, Unconjugated, Polyclonal

Catalog Number: LS-B15413-50
Article Name: IHC-plus(TM) PVRL2 / CD112 Antibody LS-B15413, Unconjugated, Polyclonal
Biozol Catalog Number: LS-B15413-50
Supplier Catalog Number: LS-B15413-50
Alternative Catalog Number: LS-B15413-50
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
Conjugation: Unconjugated
Alternative Names: PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2
CD112 antibody LS-B15413 is an unconjugated rabbit polyclonal antibody to human CD112 (PVRL2). Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Clonality: Polyclonal
Concentration: 1.22 mg/ml
NCBI: 5819
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.
Western blot analysis of extracts of various cell lines.
Immunofluorescence analysis of HeLa cells.