Polyclonal Rabbit anti-Human GJA4 / CX37 / Connexin 37 Antibody (WB) LS-C332143

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human GJA4 / CX37 / Connexin 37 Antibody (WB) LS-C332143
• Artikelnummer: LS-C332143-100
• Hersteller Artikelnummer: LS-C332143-100
• Alternativnummer: LS-C332143-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 229-333 of human GJA4 (NP_002051.2). VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
• Konjugation: Unconjugated
• Alternative Synonym: GJA4, Connexin-37, Gap junction protein alpha 4, Gap junction alpha-4 protein, Connexin 37, CX37

Produktbeschreibung

Connexin 37 antibody LS-C332143 is an unconjugated rabbit polyclonal antibody to human Connexin 37 (GJA4 / CX37). Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 2701
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 37kDa, while the observed MW by Western blot was 43kDa.

Bilder

Western blot analysis of extracts of various cell lines.