Polyclonal Rabbit anti-Human GJA4 / CX37 / Connexin 37 Antibody (WB) LS-C332143

Catalog Number: LS-C332143-100
Article Name: Polyclonal Rabbit anti-Human GJA4 / CX37 / Connexin 37 Antibody (WB) LS-C332143
Biozol Catalog Number: LS-C332143-100
Supplier Catalog Number: LS-C332143-100
Alternative Catalog Number: LS-C332143-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 229-333 of human GJA4 (NP_002051.2). VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
Conjugation: Unconjugated
Alternative Names: GJA4, Connexin-37, Gap junction protein alpha 4, Gap junction alpha-4 protein, Connexin 37, CX37
Connexin 37 antibody LS-C332143 is an unconjugated rabbit polyclonal antibody to human Connexin 37 (GJA4 / CX37). Validated for WB.
Clonality: Polyclonal
NCBI: 2701
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 37kDa, while the observed MW by Western blot was 43kDa.
Western blot analysis of extracts of various cell lines.