Polyclonal Rabbit anti-Human ITGB3 / Integrin Beta 3 / CD61 Antibody (IHC, WB) LS-C332152

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human ITGB3 / Integrin Beta 3 / CD61 Antibody (IHC, WB) LS-C332152
• Artikelnummer: LS-C332152-100
• Hersteller Artikelnummer: LS-C332152-100
• Alternativnummer: LS-C332152-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 610-718 of human ITGB3 (NP_000203.2). GSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD
• Konjugation: Unconjugated
• Alternative Synonym: ITGB3, BDPLT2, CD61 antigen, GT, gp3A, CD61, GPIIIa, Integrin beta-3

Produktbeschreibung

CD61 antibody LS-C332152 is an unconjugated rabbit polyclonal antibody to CD61 (ITGB3 / Integrin Beta 3) from human. It is reactive with human and rat. Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 2.22 mg/ml
• NCBI: 3690
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 86kDa/87kDa, while the observed MW by Western blot was 110kDa.

Bilder

Western blot analysis of extracts of various cells.