Polyclonal Rabbit anti-Human ITGB3 / Integrin Beta 3 / CD61 Antibody (IHC, WB) LS-C332152

Product Overview

• Article Name: Polyclonal Rabbit anti-Human ITGB3 / Integrin Beta 3 / CD61 Antibody (IHC, WB) LS-C332152
• Biozol Catalog Number: LS-C332152-100
• Supplier Catalog Number: LS-C332152-100
• Alternative Catalog Number: LS-C332152-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 610-718 of human ITGB3 (NP_000203.2). GSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD
• Conjugation: Unconjugated
• Alternative Names: ITGB3, BDPLT2, CD61 antigen, GT, gp3A, CD61, GPIIIa, Integrin beta-3

Product Description

CD61 antibody LS-C332152 is an unconjugated rabbit polyclonal antibody to CD61 (ITGB3 / Integrin Beta 3) from human. It is reactive with human and rat. Validated for IHC and WB.

Product Properties

• Clonality: Polyclonal
• Concentration: 2.22 mg/ml
• NCBI: 3690
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 86kDa/87kDa, while the observed MW by Western blot was 110kDa.

Images

Western blot analysis of extracts of various cells.