SUMO2 Antibody LS-C332176, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SUMO2 Antibody LS-C332176, Unconjugated, Polyclonal
• Artikelnummer: LS-C332176-100
• Hersteller Artikelnummer: LS-C332176-100
• Alternativnummer: LS-C332176-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, IHC, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3). MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
• Konjugation: Unconjugated
• Alternative Synonym: SUMO2, HSMT3, SMT3 homolog 2, SMT3A, Sentrin 2, Smt3B, SMT3H2, SUMO-2, SUMO-3, Sentrin-2, Ubiquitin-like protein SMT3A, Ubiquitin-like protein SMT3B

Produktbeschreibung

SUMO2 antibody LS-C332176 is an unconjugated rabbit polyclonal antibody to SUMO2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 6613
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 8kDa/10kDa, while the observed MW by Western blot was 17kDa.

Bilder

Western blot analysis of extracts of various cell lines, using SUMO2 antibody.

Immunofluorescence analysis of U2OS cell using SUMO2 antibody. Blue: DAPI for nuclear staining.

Immunohistochemistry of paraffin-embedded rat lung tissue.