SUMO2 Antibody LS-C332176, Unconjugated, Polyclonal

Catalog Number: LS-C332176-100
Article Name: SUMO2 Antibody LS-C332176, Unconjugated, Polyclonal
Biozol Catalog Number: LS-C332176-100
Supplier Catalog Number: LS-C332176-100
Alternative Catalog Number: LS-C332176-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3). MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Conjugation: Unconjugated
Alternative Names: SUMO2, HSMT3, SMT3 homolog 2, SMT3A, Sentrin 2, Smt3B, SMT3H2, SUMO-2, SUMO-3, Sentrin-2, Ubiquitin-like protein SMT3A, Ubiquitin-like protein SMT3B
SUMO2 antibody LS-C332176 is an unconjugated rabbit polyclonal antibody to SUMO2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 6613
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 8kDa/10kDa, while the observed MW by Western blot was 17kDa.
Western blot analysis of extracts of various cell lines, using SUMO2 antibody.
Immunofluorescence analysis of U2OS cell using SUMO2 antibody. Blue: DAPI for nuclear staining.
Immunohistochemistry of paraffin-embedded rat lung tissue.