RAD50 Antibody LS-C332354, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RAD50 Antibody LS-C332354, Unconjugated, Polyclonal
• Artikelnummer: LS-C332354-20
• Hersteller Artikelnummer: LS-C332354-20
• Alternativnummer: LS-C332354-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, IHC, IP, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAD50 (NP_005723.2). MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSM
• Konjugation: Unconjugated
• Alternative Synonym: RAD50, DNA repair protein RAD50, HRad50, NBSLD, RAD50 (S. cerevisiae) homolog, RAD50 homolog (S. cerevisiae), RAD502, RAD50-2

Produktbeschreibung

RAD50 antibody LS-C332354 is an unconjugated rabbit polyclonal antibody to RAD50 from human. It is reactive with human, mouse and rat. Validated for IF, IHC, IP and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 10111
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: IF (1:50 - 1:100), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 138kDa/153kDa/154kDa, while the observed MW by Western blot was 170kDa.

Bilder

Western blot analysis of extracts of various cell lines.

Immunohistochemistry of paraffin-embedded human metrocarcinoma tissue.

Immunofluorescence analysis of U2OS cells.