Polyclonal Rabbit anti-Human RAD50 Antibody (IHC, IF, WB) LS-C332354

Artikelnummer: LS-C332354-20
Artikelname: Polyclonal Rabbit anti-Human RAD50 Antibody (IHC, IF, WB) LS-C332354
Artikelnummer: LS-C332354-20
Hersteller Artikelnummer: LS-C332354-20
Alternativnummer: LS-C332354-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAD50 (NP_005723.2). MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSM
Konjugation: Unconjugated
Alternative Synonym: RAD50, DNA repair protein RAD50, HRad50, NBSLD, RAD50 (S. cerevisiae) homolog, RAD50 homolog (S. cerevisiae), RAD502, RAD50-2
RAD50 antibody LS-C332354 is an unconjugated rabbit polyclonal antibody to RAD50 from human. It is reactive with human, mouse and rat. Validated for IF, IHC, IP and WB.
Klonalität: Polyclonal
NCBI: 10111
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:100), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 138kDa/153kDa/154kDa, while the observed MW by Western blot was 170kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human metrocarcinoma tissue.
Immunofluorescence analysis of U2OS cells.