RAD50 Antibody LS-C332354, Unconjugated, Polyclonal

Product Overview

• Article Name: RAD50 Antibody LS-C332354, Unconjugated, Polyclonal
• Biozol Catalog Number: LS-C332354-20
• Supplier Catalog Number: LS-C332354-20
• Alternative Catalog Number: LS-C332354-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC, IP, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAD50 (NP_005723.2). MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSM
• Conjugation: Unconjugated
• Alternative Names: RAD50, DNA repair protein RAD50, HRad50, NBSLD, RAD50 (S. cerevisiae) homolog, RAD50 homolog (S. cerevisiae), RAD502, RAD50-2

Product Description

RAD50 antibody LS-C332354 is an unconjugated rabbit polyclonal antibody to RAD50 from human. It is reactive with human, mouse and rat. Validated for IF, IHC, IP and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 10111
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: IF (1:50 - 1:100), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 138kDa/153kDa/154kDa, while the observed MW by Western blot was 170kDa.

Images

Western blot analysis of extracts of various cell lines.

Immunohistochemistry of paraffin-embedded human metrocarcinoma tissue.

Immunofluorescence analysis of U2OS cells.