F2RL1 / PAR2 Antibody (aa349-383) LS-C407912, Unconjugated, Rabbit, Polyclonal

Artikelnummer: LS-C407912-10
Artikelname: F2RL1 / PAR2 Antibody (aa349-383) LS-C407912, Unconjugated, Rabbit, Polyclonal
Artikelnummer: LS-C407912-10
Hersteller Artikelnummer: LS-C407912-10
Alternativnummer: LS-C407912-10
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human PAR2 (349-383 aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
Konjugation: Unconjugated
Alternative Synonym: F2RL1, PAR2, Thrombin receptor-like 1, Protease-activated receptor 2, G-protein coupled receptor 11, GPR11, PAR-2
Klonalität: Polyclonal
NCBI: 2150
Reinheit: Immunogen affinity purified
Formulierung: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Anwendungsbeschreibung: WB (0.1 - 0.5 µg/ml)