F2RL1 / PAR2 Antibody (aa349-383) LS-C407912, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C407912-10
Article Name: F2RL1 / PAR2 Antibody (aa349-383) LS-C407912, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C407912-10
Supplier Catalog Number: LS-C407912-10
Alternative Catalog Number: LS-C407912-10
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human PAR2 (349-383 aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
Conjugation: Unconjugated
Alternative Names: F2RL1, PAR2, Thrombin receptor-like 1, Protease-activated receptor 2, G-protein coupled receptor 11, GPR11, PAR-2
Clonality: Polyclonal
NCBI: 2150
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Application Notes: WB (0.1 - 0.5 µg/ml)