Polyclonal Rabbit anti-Human FZD10 / Frizzled 10 Antibody (Biotin, C-Terminus, IF) LS-C441873

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human FZD10 / Frizzled 10 Antibody (Biotin, C-Terminus, IF) LS-C441873
• Artikelnummer: LS-C441873-100
• Hersteller Artikelnummer: LS-C441873-100
• Alternativnummer: LS-C441873-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF
• Spezies Reaktivität: Human, Porcine
• Immunogen: Synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%), Dog, Horse, Mouse, Bovine (92%).
• Konjugation: Biotin
• Alternative Synonym: FZD10, CD350 antigen, CD350, FZ-10, Frizzled homolog 10, HFz10, Frizzled 10, Frizzled family receptor 10, Frizzled-10, FzE7, Fz10

Produktbeschreibung

Frizzled 10 antibody LS-C441873 is a biotin-conjugated rabbit polyclonal antibody to Frizzled 10 (FZD10) (C-Terminus) from human. It is reactive with human and pig. Validated for IF.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1 mg/ml
• NCBI: 11211
• Puffer: PBS
• Reinheit: Immunoaffinity purified
• Formulierung: PBS

Anwendungsbeschreibung

• Application Verdünnung: IF
• Anwendungsbeschreibung: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.