Polyclonal Rabbit anti-Human FZD10 / Frizzled 10 Antibody (Biotin, C-Terminus, IF) LS-C441873

Product Overview

• Article Name: Polyclonal Rabbit anti-Human FZD10 / Frizzled 10 Antibody (Biotin, C-Terminus, IF) LS-C441873
• Biozol Catalog Number: LS-C441873-100
• Supplier Catalog Number: LS-C441873-100
• Alternative Catalog Number: LS-C441873-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IF
• Species Reactivity: Human, Porcine
• Immunogen: Synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%), Dog, Horse, Mouse, Bovine (92%).
• Conjugation: Biotin
• Alternative Names: FZD10, CD350 antigen, CD350, FZ-10, Frizzled homolog 10, HFz10, Frizzled 10, Frizzled family receptor 10, Frizzled-10, FzE7, Fz10

Product Description

Frizzled 10 antibody LS-C441873 is a biotin-conjugated rabbit polyclonal antibody to Frizzled 10 (FZD10) (C-Terminus) from human. It is reactive with human and pig. Validated for IF.

Product Properties

• Clonality: Polyclonal
• Concentration: 1 mg/ml
• NCBI: 11211
• Buffer: PBS
• Purity: Immunoaffinity purified
• Form: PBS

Application Notes

• Application Dilute: IF
• Application Notes: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.