Polyclonal Rabbit anti-Human STIL Antibody (WB) LS-C497056

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human STIL Antibody (WB) LS-C497056
• Artikelnummer: LS-C497056-20
• Hersteller Artikelnummer: LS-C497056-20
• Alternativnummer: LS-C497056-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF
• Konjugation: Unconjugated
• Alternative Synonym: STIL, MCPH7, SIL, TAL1 (SCL) interrupting locus, SCL-interrupting locus protein, SCL/TAL1 interrupting locus

Produktbeschreibung

STIL antibody LS-C497056 is an unconjugated rabbit polyclonal antibody to human STIL. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 6491
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 142kDa/143kDa, while the observed MW by Western blot was 143kDa.