Polyclonal Rabbit anti-Human STIL Antibody (WB) LS-C497056

Artikelnummer: LS-C497056-20
Artikelname: Polyclonal Rabbit anti-Human STIL Antibody (WB) LS-C497056
Artikelnummer: LS-C497056-20
Hersteller Artikelnummer: LS-C497056-20
Alternativnummer: LS-C497056-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF
Konjugation: Unconjugated
Alternative Synonym: STIL, MCPH7, SIL, TAL1 (SCL) interrupting locus, SCL-interrupting locus protein, SCL/TAL1 interrupting locus
STIL antibody LS-C497056 is an unconjugated rabbit polyclonal antibody to human STIL. Validated for WB.
Klonalität: Polyclonal
NCBI: 6491
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 142kDa/143kDa, while the observed MW by Western blot was 143kDa.