Polyclonal Rabbit anti-Human STIL Antibody (WB) LS-C497056

Product Overview

• Article Name: Polyclonal Rabbit anti-Human STIL Antibody (WB) LS-C497056
• Biozol Catalog Number: LS-C497056-20
• Supplier Catalog Number: LS-C497056-20
• Alternative Catalog Number: LS-C497056-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF
• Conjugation: Unconjugated
• Alternative Names: STIL, MCPH7, SIL, TAL1 (SCL) interrupting locus, SCL-interrupting locus protein, SCL/TAL1 interrupting locus

Product Description

STIL antibody LS-C497056 is an unconjugated rabbit polyclonal antibody to human STIL. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 6491
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 142kDa/143kDa, while the observed MW by Western blot was 143kDa.