Polyclonal Rabbit anti-Human PCNA-Associated Factor Antibody (WB) LS-C497066

Artikelnummer: LS-C497066-20
Artikelname: Polyclonal Rabbit anti-Human PCNA-Associated Factor Antibody (WB) LS-C497066
Artikelnummer: LS-C497066-20
Hersteller Artikelnummer: LS-C497066-20
Alternativnummer: LS-C497066-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human KIAA0101 (NP_055551.1). MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Konjugation: Unconjugated
Alternative Synonym: PCLAF , KIAA0101, NS5ATP9, OEATC-1, OEATC1, p15(PAF), p15/PAF, PAF, PCNA-associated factor, L5, OEATC, p15PAF, PAF15
PCNA-Associated Factor antibody LS-C497066 is an unconjugated rabbit polyclonal antibody to mouse PCNA-Associated Factor. Validated for WB.
Klonalität: Polyclonal
NCBI: 9768
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 7kDa/11kDa, while the observed MW by Western blot was 12kDa.