Polyclonal Rabbit anti-Human PCNA-Associated Factor Antibody (WB) LS-C497066

Catalog Number: LS-C497066-20
Article Name: Polyclonal Rabbit anti-Human PCNA-Associated Factor Antibody (WB) LS-C497066
Biozol Catalog Number: LS-C497066-20
Supplier Catalog Number: LS-C497066-20
Alternative Catalog Number: LS-C497066-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human KIAA0101 (NP_055551.1). MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Conjugation: Unconjugated
Alternative Names: PCLAF , KIAA0101, NS5ATP9, OEATC-1, OEATC1, p15(PAF), p15/PAF, PAF, PCNA-associated factor, L5, OEATC, p15PAF, PAF15
PCNA-Associated Factor antibody LS-C497066 is an unconjugated rabbit polyclonal antibody to mouse PCNA-Associated Factor. Validated for WB.
Clonality: Polyclonal
NCBI: 9768
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 7kDa/11kDa, while the observed MW by Western blot was 12kDa.