Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069

Artikelnummer: LS-C497069-100
Artikelname: Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069
Artikelnummer: LS-C497069-100
Hersteller Artikelnummer: LS-C497069-100
Alternativnummer: LS-C497069-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2). IRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS
Konjugation: Unconjugated
Alternative Synonym: HNRNPLL, HnRNPLL, HNRPLL, SRRF, Stromal RNA regulating factor, Stromal RNA-regulating factor
HNRPLL antibody LS-C497069 is an unconjugated rabbit polyclonal antibody to HNRPLL (HnRNPLL) from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 92906
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 30kDa/31kDa/56kDa/59kDa/60kDa, while the observed MW by Western blot was 60kDa.