Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069

Catalog Number: LS-C497069-100
Article Name: Polyclonal Rabbit anti-Human HnRNPLL / HNRPLL Antibody (WB) LS-C497069
Biozol Catalog Number: LS-C497069-100
Supplier Catalog Number: LS-C497069-100
Alternative Catalog Number: LS-C497069-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2). IRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS
Conjugation: Unconjugated
Alternative Names: HNRNPLL, HnRNPLL, HNRPLL, SRRF, Stromal RNA regulating factor, Stromal RNA-regulating factor
HNRPLL antibody LS-C497069 is an unconjugated rabbit polyclonal antibody to HNRPLL (HnRNPLL) from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 92906
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 30kDa/31kDa/56kDa/59kDa/60kDa, while the observed MW by Western blot was 60kDa.